PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462875397
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 372aa    MW: 41779.8 Da    PI: 8.7156
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462875397genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.64e-171796894
               -HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3  8 sdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
               s+v++s    +p +f+ ++ +++++++  ++l+ +sg++W+v l  +   ++  +t+GWkeFv ++ L+ g ++vF++dg+sef+ vv
  462875397 17 SSVSASE---IPQPFC-KYlKEEPNRP--VSLKGPSGNTWQVML--TSVEKGLGFTQGWKEFVADHSLQPGYILVFTYDGHSEFSVVV 96
               5555555...9*****.5547777776..***************..78888899**************************99995544 PP

2B352.68.3e-17268358498
                E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                v++  dv     + +p +f++e+    +++k++tl d++ + Wev++ y++ ++   +++GW +F+  n+L+  D++vF+l +++    +v+++r
  462875397 268 VMMECDVYVGFFMNIPCEFVREYLP--KSGKKMTLWDPQAKPWEVQYVYNNEGSIAAFSGGWGKFAVGNNLEKFDVCVFELLKEDH--IKVHIYR 358
                66777777788899*********53..36789*****************999999*************************987444..5888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.2537100IPR003340B3 DNA binding domain
SMARTSM010198.7E-1110100IPR003340B3 DNA binding domain
SuperFamilySSF1019361.79E-1814100IPR015300DNA-binding pseudobarrel domain
PfamPF023621.3E-141796IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.7E-1821100IPR015300DNA-binding pseudobarrel domain
CDDcd100174.02E-162498No hitNo description
Gene3DG3DSA:2.40.330.101.2E-25256358IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-24258358IPR015300DNA-binding pseudobarrel domain
CDDcd100171.92E-25263358No hitNo description
PROSITE profilePS5086312.731265360IPR003340B3 DNA binding domain
SMARTSM010191.7E-13265360IPR003340B3 DNA binding domain
PfamPF023628.9E-15268359IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGIAVCQLCR LASITMSSVS ASEIPQPFCK YLKEEPNRPV SLKGPSGNTW QVMLTSVEKG  60
LGFTQGWKEF VADHSLQPGY ILVFTYDGHS EFSVVVLSNS GVDDTSALDA QPSEERVVQA  120
EVEEGAQDAE AAGSSEQEAS PLPTVESNEK TGNRVRQGMV KSPAPNRHLT VQKKIEKRKP  180
KAFVDTSKAG STFPDSSKYF SFMLYEYSSY NKSETRSKNM PRVGKVVSKK LRQPVVISQR  240
RRITEEEKAH ALKMAKEFKS KNPFTLQVMM ECDVYVGFFM NIPCEFVREY LPKSGKKMTL  300
WDPQAKPWEV QYVYNNEGSI AAFSGGWGKF AVGNNLEKFD VCVFELLKED HIKVHIYRTV  360
PHITPLLLNK SM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_B8e-1323836322146B3 domain-containing transcription factor VRN
4i1k_A8e-1323836322146B3 domain-containing transcription factor VRN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978926.11e-133PREDICTED: B3 domain-containing protein Os11g0197600-like
SwissprotQ2R9D21e-109Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0A9DCS31e-136A0A0A9DCS3_ARUDO; Uncharacterized protein
STRINGSi027380m1e-135(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.17e-31B3 family protein